| Edit |   |
|---|
| Antigenic Specificity | CDC45L |
|---|
| Clone | 4C2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC45L Antibody (4C2) from Novus Biologicals is a mouse monoclonal antibody to CDC45L. This antibody reacts with human. The CDC45L Antibody (4C2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDC45L (NP_003495 477 a.a. - 566 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS |
|---|
| Other Names | CDC45 cell division cycle 45-like (S. cerevisiae), cell division cycle 45 homolog (S. cerevisiae), cell division cycle 45-like 2, human CDC45, S.cerevisiae, homolog)-like |
|---|
| Gene, Accession # | CDC45, Gene ID: 8318, Accession: NP_003495, SwissProt: NP_003495 |
|---|
| Catalog # | H00008318-M02 |
|---|
| Price | |
|---|
| Order / More Info | CDC45L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|