| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC5L |
|---|
| Clone | 3C12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC5L Antibody (3C12) from Novus Biologicals is a mouse monoclonal antibody to CDC5L. This antibody reacts with human. The CDC5L Antibody (3C12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDC5L (NP_001244 719 a.a. - 802 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF |
|---|
| Other Names | CDC5, CDC5 (cell division cycle 5, S. pombe, homolog)-like, CDC5 cell division cycle 5-like (S. pombe), Cdc5-like protein, Cdc5-related protein, CEF1, cell division cycle 5-like protein, dJ319D22.1, dJ319D22.1 (CDC5-like protein), hCDC5, KIAA0432, PCDC5RPCDC5-LIKE, Pombe cdc5-related protein |
|---|
| Gene, Accession # | CDC5L, Gene ID: 988, Accession: NP_001244, SwissProt: NP_001244 |
|---|
| Catalog # | H00000988-M08 |
|---|
| Price | |
|---|
| Order / More Info | CDC5L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|