| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat Neuronal 3 (LRRN3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown. |
|---|
| Immunogen | LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL |
|---|
| Other Names | nlrr3|nlrr-3|MGC146637|FIGLER5|NLRR-3|NLRR3|Nlrr3 |
|---|
| Gene, Accession # | Gene ID: 54674 |
|---|
| Catalog # | ABIN634977 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat Neuronal 3 (LRRN3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|