| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat Neuronal 2 (LRRN2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. |
|---|
| Immunogen | LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS |
|---|
| Other Names | GAC1|LRRN5|LRANK1|FIGLER7|LRRN2 |
|---|
| Gene, Accession # | Gene ID: 10446 |
|---|
| Catalog # | ABIN635276 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat Neuronal 2 (LRRN2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|