| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EVI5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 23910958). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EVI5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVI5. This antibody reacts with human, mouse. The EVI5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse EVI5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD |
|---|
| Other Names | dJ846D11.1 (ecotropic viral integration site 5), ecotropic viral integration site 5, ecotropic viral integration site 5 protein homolog, EVI-5, NB4SNeuroblastoma stage 4S gene protein |
|---|
| Gene, Accession # | EVI5, Gene ID: 7813 |
|---|
| Catalog # | NBP1-82596 |
|---|
| Price | |
|---|
| Order / More Info | EVI5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23910958 |
|---|
| 产品资料 |
|
|