| Edit |   |
|---|
| Antigenic Specificity | EVI2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EVI2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVI2A. This antibody reacts with human. The EVI2A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to EVI2A (ecotropic viral integration site 2A) The peptide sequence was selected from the C terminal of EVI2A. Peptide sequence LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT. |
|---|
| Other Names | ecotropic viral integration site 2A, EVDAEVI2Ecotropic viral integration site 2A protein homolog, EVI-2A, protein EVI2A |
|---|
| Gene, Accession # | EVI2A, Gene ID: 2123, Accession: P22794, SwissProt: P22794 |
|---|
| Catalog # | NBP1-68926 |
|---|
| Price | |
|---|
| Order / More Info | EVI2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|