| Edit |   |
| Antigenic Specificity | EVI2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EVI2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVI2A. This antibody reacts with human. The EVI2A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to EVI2A (ecotropic viral integration site 2A) The peptide sequence was selected from the C terminal of EVI2A. Peptide sequence LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT. |
| Other Names | ecotropic viral integration site 2A, EVDAEVI2Ecotropic viral integration site 2A protein homolog, EVI-2A, protein EVI2A |
| Gene, Accession # | EVI2A, Gene ID: 2123, Accession: P22794, SwissProt: P22794 |
| Catalog # | NBP1-68926-20ul |
| Price | |
| Order / More Info | EVI2A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |