| 产品详情 |
| Edit |   |
| Antigenic Specificity | B-Raf |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The B-Raf Antibody from Novus Biologicals is a rabbit polyclonal antibody to B-Raf. This antibody reacts with human. The B-Raf Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human B-Raf antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL |
| Other Names | 94 kDa B-raf protein, B-Raf proto-oncogene serine/threonine-protein kinase (p94), B-RAF1, BRAF1MGC126806, EC 2.7.11.1, MGC138284, murine sarcoma viral (v-raf) oncogene homolog B1, NS7, p94, Proto-oncogene B-Raf, RAFB1, serine/threonine-protein kinase B-raf, v-raf murine sarcoma viral oncogene homolog B1FLJ95109 |
| Gene, Accession # | BRAF, Gene ID: 673 |
| Catalog # | NBP2-58818 |
| Price | |
| Order / More Info | B-Raf Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|