| 产品详情 |
| Edit |   |
| Antigenic Specificity | B-Raf |
| Clone | 2F7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The B-Raf Antibody (2F7) from Novus Biologicals is a mouse monoclonal antibody to B-Raf. This antibody reacts with human. The B-Raf Antibody (2F7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | BRAF (NP_004324, 138 a.a. - 231 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP |
| Other Names | 94 kDa B-raf protein, B-Raf proto-oncogene serine/threonine-protein kinase (p94), B-RAF1, BRAF1MGC126806, EC 2.7.11.1, MGC138284, murine sarcoma viral (v-raf) oncogene homolog B1, NS7, p94, Proto-oncogene B-Raf, RAFB1, serine/threonine-protein kinase B-raf, v-raf murine sarcoma viral oncogene homolog B1FLJ95109 |
| Gene, Accession # | BRAF, Gene ID: 673, Accession: NP_004324, SwissProt: NP_004324 |
| Catalog # | H00000673-M04 |
| Price | |
| Order / More Info | B-Raf Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|