| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHSY1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHSY1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHSY1. This antibody reacts with human. The CHSY1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CHSY1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKI NILIPLSGRFDMFVRFMGNFEKTC |
|---|
| Other Names | Chondroitin glucuronyltransferase 1, chondroitin glucuronyltransferase II, chondroitin sulfate synthase 1, Chondroitin synthase 1, CHSY, ChSy-1, CSS1DKFZp434M032, EC 2.4.1.175, EC 2.4.1.226, FLJ58581, Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase 1, KIAA0990carbohydrate (chondroitin) synthase 1, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1, N-acetylgalactosaminyltransferase 1, N-acetylgalactosaminyltransferase II |
|---|
| Gene, Accession # | CHSY1, Gene ID: 22856 |
|---|
| Catalog # | NBP2-13838 |
|---|
| Price | |
|---|
| Order / More Info | CHSY1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|