| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHTF18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHTF18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHTF18. This antibody reacts with human. The CHTF18 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CHTF18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL |
|---|
| Other Names | C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like |
|---|
| Gene, Accession # | CHTF18, Gene ID: 63922 |
|---|
| Catalog # | NBP2-55371 |
|---|
| Price | |
|---|
| Order / More Info | CHTF18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|