| 产品详情 |
| Edit |   |
| Antigenic Specificity | ch-TOG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ch-TOG Antibody from Novus Biologicals is a rabbit polyclonal antibody to ch-TOG. This antibody reacts with human. The ch-TOG Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ch-TOG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI |
| Other Names | Ch-TOG, CHTOG, Colonic and hepatic tumor over-expressed gene protein, cytoskeleton associated protein 5, cytoskeleton-associated protein 5, EC 2.7.7.6, EC 3.1.1.29, KIAA0097FLJ35359, MSPS, TOG, TOGp |
| Gene, Accession # | CKAP5, Gene ID: 9793 |
| Catalog # | NBP1-85624 |
| Price | |
| Order / More Info | ch-TOG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|