| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLGLB2 |
|---|
| Clone | 3E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLGLB2 Antibody (3E6) from Novus Biologicals is a mouse monoclonal antibody to PLGLB2. This antibody reacts with human. The PLGLB2 Antibody (3E6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PLGLB2 (NP_002656, 21 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK |
|---|
| Other Names | EC 3.4.21.7, plasminogen pseudogene 1, plasminogen-like B2, plasminogen-related protein B, PLGL, PLGLB1, PLGP1, PRGB, type B plasminogen related |
|---|
| Gene, Accession # | PLGLB2, Gene ID: 5342, SwissProt: NP_002656 |
|---|
| Catalog # | H00005342-M04 |
|---|
| Price | |
|---|
| Order / More Info | PLGLB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|