| Edit |   |
|---|
| Antigenic Specificity | AKT1 Substrate 1 (Proline-Rich) (AKT1S1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress. |
|---|
| Immunogen | AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE |
|---|
| Other Names | MGC81452|lobe|pras40|fb34a04|wu:fb34a04|Lobe|PRAS40|1110012J22Rik|AI227026|Lobel |
|---|
| Gene, Accession # | Gene ID: 84335,67605,292887 |
|---|
| Catalog # | ABIN631641 |
|---|
| Price | |
|---|
| Order / More Info | AKT1 Substrate 1 (Proline-Rich) (AKT1S1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|