| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JNK/JIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JNK/JIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to JNK/JIP3. This antibody reacts with human. The JNK/JIP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human JNK/JIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF |
|---|
| Other Names | C-jun-amino-terminal kinase interacting protein 3, C-Jun-amino-terminal kinase-interacting protein 3, DKFZp762N1113, homolog of Drosophila Sunday driver 2, JIP-3, JIP3FLJ00027, JNK MAP kinase scaffold protein 3, JNK/SAPK-associated protein-1, JNK/stress-activated protein kinase-associated protein 1, JNK-interacting protein 3, JSAP1, KIAA1066SYD2, mitogen-activated protein kinase 8 interacting protein 3, Mitogen-activated protein kinase 8-interacting protein 3, syd |
|---|
| Gene, Accession # | MAPK8IP3, Gene ID: 23162 |
|---|
| Catalog # | NBP2-49593 |
|---|
| Price | |
|---|
| Order / More Info | JNK/JIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|