| Edit |   |
|---|
| Antigenic Specificity | DGK-iota |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DGK-iota Antibody from Novus Biologicals is a rabbit polyclonal antibody to DGK-iota. This antibody reacts with human. The DGK-iota Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DGK-iota antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET |
|---|
| Other Names | DAG kinase iota, DGK-IOTA, diacylglycerol kinase iota, diacylglycerol kinase, iota, Diglyceride kinase iota, EC 2.7.1.107 |
|---|
| Gene, Accession # | DGKI, Gene ID: 9162 |
|---|
| Catalog # | NBP1-85227 |
|---|
| Price | |
|---|
| Order / More Info | DGK-iota Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|