| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CAR/NR1I3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CAR/NR1I3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAR/NR1I3. This antibody reacts with human. The CAR/NR1I3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1, group I, member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG. |
|---|
| Other Names | CARCAR1, Constitutive activator of retinoid response, constitutive active receptor, Constitutive active response, Constitutive androstane receptor, MB67, MGC150433, MGC97144, MGC97209, nuclear receptor subfamily 1 group I member 3, nuclear receptor subfamily 1, group I, member 3, orphan nuclear hormone receptor, Orphan nuclear receptor MB67 |
|---|
| Gene, Accession # | NR1I3, Gene ID: 9970, Accession: Q14994, SwissProt: Q14994 |
|---|
| Catalog # | NBP1-54935 |
|---|
| Price | |
|---|
| Order / More Info | CAR/NR1I3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|