| Edit |   |
| Antigenic Specificity | Amphiphysin (AMPH) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. |
| Immunogen | Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA |
| Other Names | Amp|CG8604|DAMP|Damp|Dmel\\CG8604|amph|dAmph|damph|AMPH|Amph|GB16263|AMPH1|Amph1|wu:fq25h04|zgc:73193 |
| Gene, Accession # | Gene ID: 273,218038,60668 |
| Catalog # | ABIN632382 |
| Price | |
| Order / More Info | Amphiphysin (AMPH) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |