| Edit |   |
| Antigenic Specificity | ATP/GTP Binding Protein-Like 5 (AGBL5) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown. |
| Immunogen | AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS |
| Other Names | zgc:91997|MGC83526|AGBL5|ccp5|4930455N08|9430057O19Rik|CCP5 |
| Gene, Accession # | Gene ID: 60509 |
| Catalog # | ABIN630529 |
| Price | |
| Order / More Info | ATP/GTP Binding Protein-Like 5 (AGBL5) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |