Edit |   |
Antigenic Specificity | ASAP3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 79%, rat 82%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ASAP3 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA |
Other Names | ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, CENTB6, DDEFL1, FLJ20199, UPLC1 |
Gene, Accession # | Gene ID: 55616, UniProt: Q8TDY4, ENSG00000088280 |
Catalog # | HPA020537 |
Price | |
Order / More Info | ASAP3 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |