| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDSS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDSS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDSS2. This antibody reacts with human, mouse, rat. The PDSS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PDSS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTSAIDLCRY |
| Other Names | All-trans-decaprenyl-diphosphate synthase subunit 2, bA59I9.3, C6orf210decaprenyl-diphosphate synthase subunit 2, Candidate tumor suppressor protein, chromosome 6 open reading frame 210, Decaprenyl pyrophosphate synthase subunit 2, decaprenyl pyrophosphate synthetase subunit 2, DLP1hDLP1, EC 2.5.1.91, prenyl (decaprenyl) diphosphate synthase, subunit 2, subunit 2 of decaprenyl diphosphate synthase |
| Gene, Accession # | PDSS2, Gene ID: 57107 |
| Catalog # | NBP1-88740 |
| Price | |
| Order / More Info | PDSS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|