| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MUL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MUL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MUL1. This antibody reacts with human, mouse. The MUL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ. |
|---|
| Other Names | C1orf166mitochondrial E3 ubiquitin ligase 1, E3 ubiquitin-protein ligase MUL1, EC 6.3.2, EC 6.3.2.-, FLJ12875, GIDERP11-401M16.2, Growth inhibition and death E3 ligase, MAPLE3 ubiquitin ligase, mitochondrial E3 ubiquitin protein ligase 1, mitochondrial ubiquitin ligase activator of NF-kB, mitochondrial ubiquitin ligase activator of NFKB 1, Mitochondrial-anchored protein ligase, MULANchromosome 1 open reading frame 166, Putative NF-kappa-B-activating protein 266, RING finger protein 218, RNF218mitochondria-anchored protein ligase |
|---|
| Gene, Accession # | MUL1, Gene ID: 79594, SwissProt: Q969V5 |
|---|
| Catalog # | NBP1-59068 |
|---|
| Price | |
|---|
| Order / More Info | MUL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24709290, 25224329 |
|---|
| 产品资料 |
|
|