| 产品详情 |
| Edit |   |
| Antigenic Specificity | PD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-PD1 Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids. |
| Other Names | programmed cell death protein 1; Programmed cell death protein 1; programmed cell death protein 1; programmed cell death 1; CD_antigen: CD279, Pdcd1; Pdcd1; PD-1; Pdc1; Ly101; Pd1; Protein PD-1; mPD-1 |
| Gene, Accession # | Pdcd1, Gene ID: 18566, NCBI: NP_032824.1, UniProt: Q02242 |
| Catalog # | MBS178592 |
| Price | |
| Order / More Info | PD1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Barber, D. L., Wherry, E. J., Masopust, D., Zhu, B., Allison, J. P., Sharpe, A. H., Freeman, G. J., Ahmed, R. Restoring function in exhausted CD8 T cells during chronic viral infection. Nature 439: 682-687, 2006. 2. Dai, H., Wan, N., Zhang, S., Moore, Y., Wan, F., Dai, Z. Cutting edge: programmed death-1 defines CD8 CD122 T cells as regulatory versus memory T cells. J. Immun. 185: 803-807, 2010. 3. Finger, L. R., Pu, J., Wasserman, R., Vibhakar, R., Louie, E., Hardy, R. R., Burrows, P. |
| 产品资料 |
|
|