| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CREB3L3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CREB3L3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CREB3L3. This antibody reacts with human. The CREB3L3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CREB3L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSP RCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELV |
|---|
| Other Names | cAMP responsive element binding protein 3-like 3, cAMP-responsive element-binding protein 3-like protein 3, CREB/ATF family transcription factor, CREB-H, CREBHMGC126557, cyclic AMP-responsive element-binding protein 3-like protein 3, MGC126553, Transcription factor CREB-H |
|---|
| Gene, Accession # | CREB3L3, Gene ID: 84699 |
|---|
| Catalog # | NBP2-13873 |
|---|
| Price | |
|---|
| Order / More Info | CREB3L3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|