| Edit |   |
| Antigenic Specificity | Poly(A) Polymerase beta (Testis Specific) (PAPOLB) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity. |
| Immunogen | PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM |
| Other Names | PAP|Paplob|Papola-ps|Papt|Plap-ps|Tpap|papolb|si:ch211-199l3.6|wu:fc43b06|wu:fp01g10|zgc:109706|PAPT|TPAP |
| Gene, Accession # | Gene ID: 56903 |
| Catalog # | ABIN633533 |
| Price | |
| Order / More Info | Poly(A) Polymerase beta (Testis Specific) (PAPOLB) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |