| Edit |   |
|---|
| Antigenic Specificity | FASTKD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FASTKD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FASTKD2. This antibody reacts with human. The FASTKD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FASTKD2(FAST kinase domains 2) The peptide sequence was selected from the middle region of FASTKD2. Peptide sequence DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR. |
|---|
| Other Names | FAST kinase domains 2, KIAA0971FAST kinase domain-containing protein 2 |
|---|
| Gene, Accession # | FASTKD2, Gene ID: 22868, Accession: Q9NYY8, SwissProt: Q9NYY8 |
|---|
| Catalog # | NBP1-55360 |
|---|
| Price | |
|---|
| Order / More Info | FASTKD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|