| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SFRS3 |
|---|
| Clone | 2D2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SFRS3 Antibody (2D2) from Novus Biologicals is a mouse monoclonal antibody to SFRS3. This antibody reacts with human, mouse, rat. The SFRS3 Antibody (2D2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SFRS3 (NP_003008, 1 a.a. - 85 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
|---|
| Other Names | Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20 |
|---|
| Gene, Accession # | SRSF3, Gene ID: 6428, Accession: NP_003008, SwissProt: NP_003008 |
|---|
| Catalog # | H00006428-M08 |
|---|
| Price | |
|---|
| Order / More Info | SFRS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19584083, 21611201 |
|---|
| 产品资料 |
|
|