| 产品详情 |
| Edit |   |
| Antigenic Specificity | SFRS8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SFRS8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFRS8. This antibody reacts with human. The SFRS8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SFRS8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD |
| Other Names | Drosophila homolog), Drosophila), SFRS8, Splicing factor, arginine/serine-rich 8, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, splicing factor, suppressor of white-apricot homolog, splicing factor, suppressor of white-apricot homolog (Drosophila), Suppressor of white apricot protein homolog, SWAPMGC167082 |
| Gene, Accession # | SFSWAP, Gene ID: 6433 |
| Catalog # | NBP1-87052 |
| Price | |
| Order / More Info | SFRS8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|