| Edit |   |
|---|
| Antigenic Specificity | Annexin A3 (ANXA3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene, ANXA3, encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. |
|---|
| Immunogen | Annexin A3 antibody was raised using the C terminal of ANXA3 corresponding to a region with amino acids RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
|---|
| Other Names | MGC80326|anxa3|zgc:101718|ANXA3|ANX3|Anx3|LC3|LRRGT00047 |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630251 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A3 (ANXA3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|