| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAR2/F2RL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human. No cross reactivity with other proteins. Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. |
|---|
| Other Names | Proteinase-activated receptor 2;PAR-2;Coagulation factor II receptor-like 1;G-protein coupled receptor 11;Thrombin receptor-like 1;Proteinase-activated receptor 2, alternate cleaved 1;Proteinase-activated receptor 2, alternate cleaved 2;F2RL1;GPR11, PAR2; |
|---|
| Gene, Accession # | F2RL1, UniProt: P55085 |
|---|
| Catalog # | PB9700 |
|---|
| Price | |
|---|
| Order / More Info | PAR2/F2RL1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|