| Edit |   |
|---|
| Antigenic Specificity | PKNOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PKNOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PKNOX2. This antibody reacts with human. The PKNOX2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PKNOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGNIAMTTVNSQVVSGGA |
|---|
| Other Names | homeobox protein PKNOX2, PBX/knFLJ13074, PBX/knPREP2Homeobox protein PREP-2 |
|---|
| Gene, Accession # | PKNOX2, Gene ID: 63876 |
|---|
| Catalog # | NBP2-55463 |
|---|
| Price | |
|---|
| Order / More Info | PKNOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|