| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alcohol dehydrogenase 5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alcohol dehydrogenase 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to alcohol dehydrogenase 5. This antibody reacts with human. The alcohol dehydrogenase 5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human alcohol dehydrogenase 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI |
|---|
| Other Names | ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase |
|---|
| Gene, Accession # | ADH5, Gene ID: 128 |
|---|
| Catalog # | NBP2-49350 |
|---|
| Price | |
|---|
| Order / More Info | alcohol dehydrogenase 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|