| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alcohol dehydrogenase 7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alcohol dehydrogenase 7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to alcohol dehydrogenase 7. This antibody reacts with human, mouse, rat. The alcohol dehydrogenase 7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human alcohol dehydrogenase 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV |
|---|
| Other Names | ADH4, ADH-4, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide, alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, alcohol dehydrogenase VII, alcohol dehydrogenase-7, class IV sigma-1 alcohol dehydrogenase, class IV sigmasigma alcohol dehydrogenase, EC 1.1.1, EC 1.1.1.1, Gastric alcohol dehydrogenase, Retinol dehydrogenase |
|---|
| Gene, Accession # | ADH7, Gene ID: 131 |
|---|
| Catalog # | NBP1-90232 |
|---|
| Price | |
|---|
| Order / More Info | alcohol dehydrogenase 7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|