| Edit |   |
| Antigenic Specificity | LACC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LACC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LACC1. This antibody reacts with mouse. The LACC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE. |
| Other Names | chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811 |
| Gene, Accession # | LACC1, Gene ID: 144811, Accession: NP_766076 |
| Catalog # | NBP1-79523 |
| Price | |
| Order / More Info | LACC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |