| Edit |   |
|---|
| Antigenic Specificity | LACC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LACC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LACC1. This antibody reacts with human. The LACC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C13ORF31 The peptide sequence was selected from the middle region of C13ORF31. Peptide sequence TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN. |
|---|
| Other Names | chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811 |
|---|
| Gene, Accession # | LACC1, Gene ID: 144811, Accession: Q8IV20, SwissProt: Q8IV20 |
|---|
| Catalog # | NBP1-56736 |
|---|
| Price | |
|---|
| Order / More Info | LACC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|