| Edit |   |
|---|
| Antigenic Specificity | CATIP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CATIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CATIP. This antibody reacts with human. The CATIP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C2ORF62 The peptide sequence was selected from the N terminal of C2ORF62. Peptide sequence MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFS. |
|---|
| Other Names | C2orf62, chromosome 2 open reading frame 62, hypothetical protein LOC375307, MGC50811 |
|---|
| Gene, Accession # | C2ORF62, Gene ID: 375307, Accession: Q6ZUJ4, SwissProt: Q6ZUJ4 |
|---|
| Catalog # | NBP1-56807-20ul |
|---|
| Price | |
|---|
| Order / More Info | CATIP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|