| Edit |   |
| Antigenic Specificity | CATIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CATIP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CATIP. This antibody reacts with human. The CATIP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C2ORF62 The peptide sequence was selected from the N terminal of C2ORF62. Peptide sequence MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFS. |
| Other Names | C2orf62, chromosome 2 open reading frame 62, hypothetical protein LOC375307, MGC50811 |
| Gene, Accession # | C2ORF62, Gene ID: 375307, Accession: Q6ZUJ4, SwissProt: Q6ZUJ4 |
| Catalog # | NBP1-56807 |
| Price | |
| Order / More Info | CATIP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |