| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CAT3/SLC7A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CAT3/SLC7A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAT3/SLC7A3. This antibody reacts with human. The CAT3/SLC7A3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CAT3/SLC7A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI |
|---|
| Other Names | ATRC3cationic amino acid transporter 3, CAT3, CAT-3Cationic amino acid transporter y+, FLJ14541, MGC20687, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, Solute carrier family 7 member 3 |
|---|
| Gene, Accession # | SLC7A3, Gene ID: 84889 |
|---|
| Catalog # | NBP1-88910 |
|---|
| Price | |
|---|
| Order / More Info | CAT3/SLC7A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|