| 产品详情 |
| Edit |   |
| Antigenic Specificity | G5pr |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The G5pr Antibody from Novus Biologicals is a rabbit polyclonal antibody to G5pr. This antibody reacts with human. The G5pr Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human G5pr antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF |
| Other Names | C14orf10, chromosome 14 open reading frame 10, FLJ20644, G4-1, G5pr, protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma, protein phosphatase 2, regulatory subunit B'', gamma, Protein phosphatase subunit G5PR, rhabdomyosarcoma antigen MU-RMS-40.6A, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C, rhabdomyosarcoma antigen Mu-RMS-40.6C, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma |
| Gene, Accession # | PPP2R3C, Gene ID: 55012 |
| Catalog # | NBP2-58168 |
| Price | |
| Order / More Info | G5pr Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|