| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ErbB3/Her3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ErbB3/Her3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ErbB3/Her3. This antibody reacts with human. The ErbB3/Her3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ErbB3/Her3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR |
|---|
| Other Names | c-erbB3, EC 2.7.10, EC 2.7.10.1, ErbB-3, erbB3-S, HER3c-erbB-3, LCCS2, lethal congenital contracture syndrome 2, MDA-BF-1, MGC88033, p180-ErbB3, p45-sErbB3, p85-sErbB3, Proto-oncogene-like protein c-ErbB-3, receptor tyrosine-protein kinase erbB-3, Tyrosine kinase-type cell surface receptor HER3, v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
|---|
| Gene, Accession # | ERBB3, Gene ID: 2065, Accession: P21860, SwissProt: P21860 |
|---|
| Catalog # | NBP2-33289 |
|---|
| Price | |
|---|
| Order / More Info | ErbB3/Her3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|