| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100G Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100G. This antibody reacts with human. The S100G Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human S100G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK |
|---|
| Other Names | CABP, CABP1, CaBP9K, CABP9KMGC138379, CALB3calbindin D9K, calbindin 3, (vitamin D-dependent calcium-binding protein), calbindin-D9K, protein S100-G, S100 calcium binding protein G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal |
|---|
| Gene, Accession # | S100G, Gene ID: 795, Accession: P29377, SwissProt: P29377 |
|---|
| Catalog # | NBP2-31615 |
|---|
| Price | |
|---|
| Order / More Info | S100G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|