| Edit |   |
| Antigenic Specificity | Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage. |
| Immunogen | CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT |
| Other Names | CSGalNAcT-1|ChGn|beta4GalNAcT|CHGN|4732435N03Rik|Chgn|RGD1307618 |
| Gene, Accession # | Gene ID: 55790 |
| Catalog # | ABIN634698 |
| Price | |
| Order / More Info | Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |