| Edit |   |
|---|
| Antigenic Specificity | Calbindin 2 (CALB2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described. |
|---|
| Immunogen | Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD |
|---|
| Other Names | CAB29|CAL2|CR|calb2l|wu:fq18e08|zgc:73115|calb2|wu:fq17g09|zgc:73099 |
|---|
| Gene, Accession # | Gene ID: 794,12308,117059 |
|---|
| Catalog # | ABIN631478 |
|---|
| Price | |
|---|
| Order / More Info | Calbindin 2 (CALB2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|