| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ArgRS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ArgRS Antibody from Novus Biologicals is a rabbit polyclonal antibody to ArgRS. This antibody reacts with human. The ArgRS Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ArgRS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQEFFQRLELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKG |
|---|
| Other Names | arginine-tRNA ligase, arginyl-tRNA synthetase 2, mitochondrial, Arginyl-tRNA synthetase-like, ArgRS, DALRD2, dJ382I10.6, EC 6.1.1.19, MGC14993, MGC23778, PCH6, PRO1992, probable arginyl-tRNA synthetase, mitochondrial, RARSLArginine--tRNA ligase |
|---|
| Gene, Accession # | RARS2, Gene ID: 57038, Accession: Q5T160, SwissProt: Q5T160 |
|---|
| Catalog # | NBP2-31923 |
|---|
| Price | |
|---|
| Order / More Info | ArgRS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|