| Edit |   |
|---|
| Antigenic Specificity | Lysine-rich coiled-coil 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lysine-rich coiled-coil 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lysine-rich coiled-coil 1. This antibody reacts with human. The Lysine-rich coiled-coil 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human KRCC1. Peptide sequence KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR. |
|---|
| Other Names | CHBP2, cryptogenic hepatitis binding protein, Cryptogenic hepatitis-binding protein 2, FLJ22333, lysine-rich coiled-coil 1, lysine-rich coiled-coil protein 1 |
|---|
| Gene, Accession # | KRCC1, Gene ID: 51315, Accession: NP_057702, SwissProt: NP_057702 |
|---|
| Catalog # | NBP1-79654-20ul |
|---|
| Price | |
|---|
| Order / More Info | Lysine-rich coiled-coil 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|