| Edit |   |
|---|
| Antigenic Specificity | RBM19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM19. This antibody reacts with human. The RBM19 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RBM19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQ |
|---|
| Other Names | KIAA0682DKFZp586F1023, NPO, probable RNA-binding protein 19, RNA binding motif protein 19, RNA-binding motif protein 19 |
|---|
| Gene, Accession # | RBM19, Gene ID: 9904 |
|---|
| Catalog # | NBP2-55043 |
|---|
| Price | |
|---|
| Order / More Info | RBM19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|