| Edit |   |
|---|
| Antigenic Specificity | RBM18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM18. This antibody reacts with human. The RBM18 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human RBM18. Peptide sequence VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL. |
|---|
| Other Names | MGC2734, RNA binding motif protein 18, RNA-binding motif protein 18 |
|---|
| Gene, Accession # | RBM18, Gene ID: 92400, Accession: NP_149108, SwissProt: NP_149108 |
|---|
| Catalog # | NBP1-80471 |
|---|
| Price | |
|---|
| Order / More Info | RBM18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|