| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM25. This antibody reacts with human. The RBM25 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RBM25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
|---|
| Other Names | Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-binding motif protein 25, RNA-binding protein 25, RNA-binding region (RNP1, RRM) containing 7, RNPC7, S164, Snu71, U1 small nuclear ribonucleoprotein 1SNRP homolog |
|---|
| Gene, Accession # | RBM25, Gene ID: 58517 |
|---|
| Catalog # | NBP2-57656 |
|---|
| Price | |
|---|
| Order / More Info | RBM25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|