| Edit |   |
|---|
| Antigenic Specificity | RBM27 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM27. This antibody reacts with human. The RBM27 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RBM27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQIFS |
|---|
| Other Names | RNA-binding protein 27, ARRS1, Psc1, RNA binding motif protein 27 |
|---|
| Gene, Accession # | RBM27, Gene ID: 54439, Accession: Q9P2N5, SwissProt: Q9P2N5 |
|---|
| Catalog # | NBP1-90818 |
|---|
| Price | |
|---|
| Order / More Info | RBM27 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|