| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM3 |
|---|
| Clone | 4D6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM3 Antibody (4D6) from Novus Biologicals is a mouse monoclonal antibody to RBM3. This antibody reacts with human, mouse. The RBM3 Antibody (4D6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | RBM3 (NP_006734.1, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD |
|---|
| Other Names | IS1-RNPL, putative RNA-binding protein 3, RNA binding motif (RNP1, RRM) protein 3, RNA binding motif protein 3, RNA-binding motif protein 3, RNPL |
|---|
| Gene, Accession # | RBM3, Gene ID: 5935, Accession: NP_006734, SwissProt: NP_006734 |
|---|
| Catalog # | H00005935-M06 |
|---|
| Price | |
|---|
| Order / More Info | RBM3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20585313, 23673116 |
|---|
| 产品资料 |
|
|